Extracted fasta sequence

Fasta Sequence:

>tr|Q93KD4|Q93KD4_EUBAC ATPase component of tungstate ABC transporter OS=Eubacterium acidaminophilum GN=tupC PE=4 SV=1
MQITVSNLKKSYGGSTVLDVESLTFESGKITGIIGPNGAGKTTLLNIISGIDMDFEGDVEYSGSDYSEVKRDITMVFQKG
GLLKRSVFENIAYPLKLRGTDKNEIQQTVVELMRHLGIEELSSKKAHKLSGGETQRVALARALAIKPRALLLDEPTASID
PEYMETIEKCIVDYNRKSKATILIITHSMDQARRLCDNIVFLESGRVGEADGFF




BacMet database and website is designed and maintained by Chandan Pal

Copyright © 2013 All rights reserved

GU logo