Extracted fasta sequence

Fasta Sequence:

>tr|Q8ZRG7|Q8ZRG7_SALTY Putative cation transport ATPase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=STM0353 PE=3 SV=1
MSQSENRHDTISLLIEGMTCASCVARVEKGIKAVPGVTDATVNLATERATVRGTASAEAVIAAIEKTGYKARPIETAGQG
EDDSEEKKEAERVRLKRDLILASVLALPVFVLEMGSHLIPGMHEWVIKTIGLQQSWYWQFALTLLVLTIPGRRFYLKGFP
ALARLAPDMNSLVAVGTAAAFGYSLVATFTPDLLPEGTVNVYYEAAAVIVALILLGRFLEARAKGRTSEAIKRLVGLQAR
VAHVLREGRIVDIPVDEVVLGDCVEVRPGERIPVDGEVTEGRSFVDESMITGEPIPVEKSAGSAVVGGTVNQKGALTLRA
TAVGGQTMLAQIIRLVEQAQGSKLPIQAVVDKVTLWFVPMVMLIAALTFVVWLAFGPSPALTFALINGVAVLIIACPCAM
GLATPTSIMVGTGRGAEMGVLFRKGEALQLLKDAKVVAVDKTGTLTEGRPVLTDLDVASGFERREVLAKVAAVESRSEHP
IARAIVVSAEEEGIALPGMSGFESVTGMGVYATVDGTRVDVGADRYMREIGVDISGFATTAERLGQEGKSPLYAAIDGQL
AAIIAVADPIKPSTPAAINALHQLGIKVAMITGDNARTAQAIARQLGIDDVVAEVLPEGKVEAIRRLKAAYGQVAFVGDG
INDAPALAESDVGLAIGTGTDVAVESADVVLMSGNLQGVPNAIALSKATIRNIHQNLFWAFAYNTALIPVAAGALFPVWG
ILLSPVFAAGAMAMSSVFVLGNALRLRRFRAPMATPSDTSTT




BacMet database and website is designed and maintained by Chandan Pal

Copyright © 2013 All rights reserved

GU logo