Extracted fasta sequence

Fasta Sequence:

>tr|Q1MJL3|Q1MJL3_RHIL3 Uncharacterized protein OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=RL1350 PE=4 SV=1
MSHTTLQKKKLVARISRLKGQMEAVERALEAERPCGEILQLLASIRGALTGLTGEVLDDHLREHVLNAADDAARAEAVEE
ISEVLRTYMR




BacMet database and website is designed and maintained by Chandan Pal

Copyright © 2013 All rights reserved

GU logo