Extracted fasta sequence

Fasta Sequence:

>tr|Q06VT0|Q06VT0_9BACT NcrY OS=Leptospirillum ferriphilum GN=ncrY PE=4 SV=1
MESAMQKQYFSQFVTGVLLTSFIAIPALAAQGGFSAEKEPVVTEHMYAGHKVQQENSQSRIQIVSSMHEGAWITLEGNVV
SQQQDEWYTFRDPTGTIKVRIPQKVWNGQHFDAQDLVRVSGPVSHENDGSILYVAVISKP




BacMet database and website is designed and maintained by Chandan Pal

Copyright © 2013 All rights reserved

GU logo