Extracted fasta sequence

Fasta Sequence:

>sp|P12375|COPB_PSEUB Copper resistance protein B OS=Pseudomonas syringae pv. tomato GN=copB PE=1 SV=1
MTVLNRLHVCSLLAVSSLGMLPVGVFAAEAAMPGVDHSQMQGMDHSKMQGMDHSQMQGMDHSKMQGMDHSQMQGMDSDMT
TMAPSKPAAPTQSRTPIAPVTDANRAAVYRSAKGHTVHDEAANYFLLFDQLEWQDADNGSVLNWDVNGWVGGDIDRLWIR
SEGERTNGKTESAELQALWGHAISPWWDLVGGVRQDFKPGSPQTWAAFGLQGLALYNFEAEATAFLGEGGQTGLRLEGDY
DILLTNRLILQPTAEVNFYGQSDPQRGIGSGLSETEVGVRLRYEIRREFAPYIGVTWNRSYGNTADFAREEGEDRSEARL
VLGVRMWF




BacMet database and website is designed and maintained by Chandan Pal

Copyright © 2013 All rights reserved

GU logo