Extracted fasta sequence

Fasta Sequence:

>sp|P0ACH5|MARA_ECOLI Multiple antibiotic resistance protein MarA OS=Escherichia coli (strain K12) GN=marA PE=1 SV=2
MSRRNTDAITIHSILDWIEDNLESPLSLEKVSERSGYSKWHLQRMFKKETGHSLGQYIRSRKMTEIAQKLKESNEPILYL
AERYGFESQQTLTRTFKNYFDVPPHKYRMTNMQGESRFLHPLNHYNS




BacMet database and website is designed and maintained by Chandan Pal

Copyright © 2013 All rights reserved

GU logo