Extracted fasta sequence

Fasta Sequence:

>sp|O52248|TTGB_PSEPT Toluene efflux pump membrane transporter TtgB OS=Pseudomonas putida (strain DOT-T1E) GN=ttgB PE=2 SV=2
MSKFFIDRPIFAWVIALVIMLVGALSILKLPINQYPSIAPPAIAIAVTYPGASAQTVQDTVVQVIEQQLNGIDNLRYVSS
ESNSDGSMTITATFEQGTNPDTAQVQVQNKLNLATPLLPQEVQQQGIRVTKAVKNFLLVIGLVSEDGSMTKDDLANYIVS
NMQDPISRTAGVGDFQVFGAQYAMRIWLDPAKLNKFQLTPVDVKTAVAAQNVQVSSGQLGGLPALPGTQLNATIIGKTRL
QTAEQFESILLKVNKDGSQVRLGDVAQVGLGGENYAVSAQFNGKPASGLAVKLATGANALDTAKALRETIKGLEPFFPPG
VKAVFPYDTTPVVTESISGVIHTLIEAVVLVFLVMYLFLQNFRATIITTMTVPVVLLGTFGILAAAGFSINTLTMFAMVL
AIGLLVDDAIVVVENVERVMSEEGLPPKEATKRSMEQIQGALVGIALVLSAVLLPMAFFGGSTGVIYRQFSITIVSAMGL
SVLVALIFTPALCATMLKPLKKGEHHTAKGGFFGWFNRNFDRSVNGYERSVGTILRNKVPFLLAYALIVVGMIWLFARIP
TAFLPEEDQGVLFAQVQTPAGSSAERTQVVVDQMREYLLKDEADTVSSVFTVNGFNFAGRGQSSGMAFIMLKPWDERSKE
NSVFALAQRAQQHFFTFRDAMVFAFAPPAVLELGNATGFDVFLQDRGGVGHAKLMEARNQFLAKAAQSKILSAVRPNGLN
DEPQYQLTIDDERASALGVTIADINNTLSIALGASYVNDFIDRGRVKKVYIQGEPSARMSPEDLQKWYVRNGAGEMVPFS
SFAKGEWTYGSPKLSRYNGVEAMEILGAPAPGYSTGEAMAEVERIAGELPSGIGFSWTGMSYEEKLSGSQMPALFALSVL
FVFLCLAALYESWSIPIAVVLVVPLGIIGALIATSLRGLSNDVYFLVGLLTTIGLAAKNAILIVEFAKELHEQGRSLYDA
AIEACRMRLRPIIMTSLAFILGVVPLTIASGAGAGSQHAIGTGVIGGMISATVLAIFWVPLFFVAVSSLFGSKEPEKDVT
PENPRYEAGQ




BacMet database and website is designed and maintained by Chandan Pal

Copyright © 2013 All rights reserved

GU logo