Extracted fasta sequence

Fasta Sequence:

>sp|O06474|YFMP_BACSU HTH-type transcriptional regulator YfmP OS=Bacillus subtilis (strain 168) GN=yfmP PE=2 SV=1
MEWMKIDQVAKRSGLTKRTIRFYEEIGLIPAPKRTDGGVRLYSEDDMEELEKVISTKEVLGFSLQELQHFMETSRQLELN
KEGYLLSLDPKERKEKLEEIQETLNHQLDLIDEKIRTFQSFKERLQGMKGKAERAIQSIE




BacMet database and website is designed and maintained by Chandan Pal

Copyright © 2013 All rights reserved

GU logo