Extracted fasta sequence

Fasta Sequence:

>tr|B2FID0|B2FID0_STRMK Putative multidrug resistance protein B OS=Stenotrophomonas maltophilia (strain K279a) GN=emrB PE=4 SV=1
MSAQAPAAPGAPGAPAAPGAASGFLPPSVALCTVGLAMASFMQVLDTTIANVSLPTIAGNLGASSQQATWVITSFAVSTA
IALPLTGWLSRRFGERKLFVWATLAFVITSLLCGLAQSMGMLVLSRALQGFVAGPMYPITQSLLVSIYPREKRGQALALL
AMITVVAPICGPILGGWITDNYSWEWIFLINVPLGIFAALVVGNQLKGRPEQIEKPKMDYVGLVTLVIGVGALQLVLDLG
NDEDWFSSMKIVVLACVAVVTLTVFLIWELTDKDPIVDLKLFRHRNFRAGTLAMVVAYAAFFSVALLIPQWLQRDMGYTA
IWAGLATAPIGILPVIMTPFVGKYASRFDMRMLATVAFIVLSMTSFLRSNFNLQVDYMHVAGVQLIMGIGVALFFMPVLQ
ILLSDLDGREIAAGSGLATFLRTLGGSFAASLTTWLWARRTQVHHADLTEHISAYQPGMQDQVTAMGQGDLQHGAAVLNN
MINHQASQMGFNDIFFLLGWIFLAIITFLWLAKPPFGAGAGAAAGGGH




BacMet database and website is designed and maintained by Chandan Pal

Copyright © 2013 All rights reserved

GU logo