Extracted fasta sequence

Fasta Sequence:

>tr|Q9KVI2|Q9KVI2_VIBCH Multidrug resistance protein, putative OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=VC_0164 PE=4 SV=1
MRFTDVFIKRPVLAVSISFLIVLLGLQAIFKMQVREYPEMTNTVITVSTGYYGASADLIQGFITQPLEQAVAQADNIDFM
TSQSVLGRSTITVTMKLNTDPNAALSDVLAKTNSVRSQLPKEAEDPTVTMSTGSTTAVLYIGFTSNELASSQITDYLERV
VNPQLYAVNGVSSIDLYGGMKYALRVWLDPAKMAALNLSAADVMSILNANNYQSATGQAIGEFVLYNGSADTQVSTVEDL
ESLVVKAEKGTVTRLGDIAKVTLAKSHDTYRASANGREAVVAAINAAPSANPINIAKDVLEMLPELQKNMPSNIEMNVLY
DSTVAINESIHEVIKTIVEAALIVLVVITLFLGSLRAVLIPIVTIPLSLIGVAMVMQMMGFSWNLMTLLAMVLAIGLVVD
DAIVVLENVDRHIKEGESPFRAAIIGTREIAIPVIAMTLTLGAVYAPIALMGGITGSLFKEFALTLAGSVFVSGIVALTL
SPMMCSKMLKANEAPNKFELKVHHLLDRMTARYERMLTAVMAHRPVVIAFAFIVFASLPMLFKFIPSELAPSEDKGVIML
MGTGPSNANLDYLANTMDDVNKILSDQPEVQFAQVFTGVPNSNQAFGIASMVPWSQREASQATVTNRVGTLVQDIPGMAV
TAFQMPELPGAGSGLPIQFVITTPSNFESLFTIATDVLTEVKANPMFVYSDLDLNFDSATMKINIDKDKAGAYGVTMQDI
GITLSTMMADGYVNRIDLNGRSYEVIPQVERKWRLNPESMNSYYVRAADGKVIPLGSLVTIDVVAEPRSLPHFNQLNSAT
VGAVPAPGTAMGDAINWFENLASSKLPKGYSHDYMGEARQYVTEGSALYATFGLALAIIFLVLAIQFESLRDPLVIMVSV
PLAICGALIALAWGTATMNIYSQVGLITLVGLITKHGILICEVAKEEQLHNKLSRIEAVMHAAKVRLRPILMTTAAMIAG
LIPLMYATGAGAAQRFSIGIVIVSGLAIGTLFTLFVLPVIYSYLAEKHKPLPVFVEDKDLEKLARIDEAKAAHRQL




BacMet database and website is designed and maintained by Chandan Pal

Copyright © 2013-2016 All rights reserved

GU logo