Extracted fasta sequence

Fasta Sequence:

>tr|Q72FN2|Q72FN2_DESVH Molybdenum ABC transporter, permease protein OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=modB PE=3 SV=1
MSDLAPILPSGVSLAAPVMLTLRVAGLATFFSFFAGVGAAWFVARGPFRGRGIIDALCALPLVLPPTVLGYYLILLVGRR
GLMGPWLAEAGINLMFSWQGAVVAATVVVFPLIYKAARAALESVDHSLERAARTLGASEWKVFVRVSLPLAWRGIFAGTM
LAFARGMGEFGATLMLAGNLPGRTQTLALAIYDAFQSGNDAQATLLVAVTSVLCMSVLLLAERLAHCGRRMWS




BacMet database and website is designed and maintained by Chandan Pal

Copyright © 2013-2016 All rights reserved

GU logo